PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT30260
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 233aa    MW: 25312.4 Da    PI: 6.2797
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT30260genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.9e-184994148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg++T eE+e +++++++lG++ W+tIa++++ gRt++++k+ w+++l
         EMT30260 49 RGNFTSEEEEAIIQLHAMLGNR-WSTIAARLP-GRTDNEIKNVWHTHL 94
                     89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-4526IPR009057Homeodomain-like
PROSITE profilePS500905.181843IPR017877Myb-like domain
SuperFamilySSF466895.47E-221090IPR009057Homeodomain-like
SMARTSM00717251345IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.5E-123056IPR009057Homeodomain-like
PROSITE profilePS5129426.4864498IPR017930Myb domain
SMARTSM007175.6E-154896IPR001005SANT/Myb domain
PfamPF002491.1E-154994IPR001005SANT/Myb domain
CDDcd001673.29E-125194No hitNo description
Gene3DG3DSA:1.10.10.604.2E-235795IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MVRAPCCEKM GLKRGPWTAE EDMTLAGLLR CGKSCRLRWI NYLRPDIKRG NFTSEEEEAI  60
IQLHAMLGNR WSTIAARLPG RTDNEIKNVW HTHLKKRLES SSKPSGQAAP KRKAKKPAVS  120
ASALEGPTSK PASSPGQSLS MSPGKSLSTS SATDYSMASS LENTGSSSSS EEFQIDDSFW  180
SETLGMSVDN SGSGMEISDT FGVDSASPSS NDEMDFWVTL FMQAGDMQSL SQI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-23121005110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9690510.0JN969051.1 Triticum aestivum MYB73 (MYB73) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575391.11e-112PREDICTED: myb-related protein Myb4-like
SwissprotQ7XBH45e-79MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLM8BZ541e-172M8BZ54_AEGTA; Myb-related protein Myb4
STRINGMLOC_34646.11e-138(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31180.14e-64myb domain protein 14